An intriguing empirical rule for computing the first normal stress difference from steady shear viscosity data for concentrated polymer solutions and melts

The Cox–Merz rule and Laun’s rule are two empirical relations that allow the estimation of steady shear viscosity and first normal stress difference, respectively, using small amplitude oscillatory shear measurements. The validity of the Cox–Merz rule and Laun’s rule imply an agreement between the linear viscoelastic response measured in small amplitude oscillatory shear and the nonlinear response measured in steady shear flow measurements. We show that by using a lesser-known relationship also proposed by Cox and Merz, in conjunction with Laun’s rule, a relationship between the rate-dependent steady shear viscosity and the first normal stress difference can be deduced. The new empirical relation enables a priori estimation of the first normal stress difference using only the steady flow curve (i.e., viscosity vs shear rate data). Comparison of the estimated first normal stress difference with the measured values for six different polymer solutions and melts show that the empirical rule provides values that are in reasonable agreement with measurements over a wide range of shear rates, thus deepening the intriguing connection between linear and nonlinear viscoelastic response of entangled polymeric materials.     

Move ordering and communities in complex networks describing the game of go

We analyze the game of go from the point of view of complex networks. We construct three different directed networks of increasing complexity, defining nodes as local patterns on plaquettes of increasing sizes, and links as actual successions of these patterns in databases of real games. We discuss the peculiarities of these networks compared to other types of networks. We explore the ranking vectors and community structure of the networks and show that this approach enables to extract groups of moves with common strategic properties. We also investigate different networks built from games with players of different levels or from different phases of the game. We discuss how the study of the community structure of these networks may help to improve the computer simulations of the game. More generally, we believe such studies may help to improve the understanding of human decision process.     

In silico characterization of alkaline proteases from different species of Aspergillus

A total of 49 protein sequences of alkaline proteases retrieved from GenBank representing different species of Aspergillus have been characterized for various physiochemical properties, homology search, multiple sequence alignment, motif, and super family search and phylogenetic tree construction. The sequence level homology was obtained among different groups of alkaline protease enzymes, viz alkaline serine protease, oryzin, calpain-like protease, serine protease, subtilisin-like alkaline proteases. Multiple sequence alignment of alkaline protease protein sequence of different Aspergillus species revealed a stretch of conserved region for amino acid residues from 69 to 110 and 130–204. The phylogenetic tree constructed indicated several Aspergillus species-specific clusters for alkaline proteases namely Aspergillus fumigatus, Aspergillus niger, Aspergillus oryzae, Aspergillus clavatus. The distributions of ten commonly observed motifs were analyzed among these proteases. Motif 1 with a signature amino acid sequence of 50 amino acids, i.e., ASFSNYGKVVDIFAPGQDILSCWIGSTTATNTISGTSMATPHIVGLSCYL, was uniformly observed in proteases protein sequences indicating its involvement with the structure and enzymatic function. Motif analysis of acidic proteases of Aspergillus and bacterial alkaline proteases has revealed different signature amino acid sequences. The superfamily search for these proteases revealed the presence of subtilases, serine-carboxyl proteinase, calpain large subunit, and thermolysin-like superfamilies with 45 representing the subtilases superfamily.     

Triblock Copolymer Based on Poly(propylene oxide) and Poly(1‐[11‐acryloylundecyl]‐3‐methyl‐imidazolium bromide)

The controlled atom transfer radical polymerization of an ionic liquid, 1‐(11‐acryloylundecyl)‐3‐methyl imidazolium bromide (ILBr), from both ends of a telechelic poly(propylene oxide) (PPO) macroinitiator, end‐functionalized with bromoisobutyryloyl is reported. The resulting highly water‐soluble triblock, poly(ILBr‐b‐PO‐b‐ILBr) is multistimuli responsive. This new class of triblocks exhibits classical surface activity in lowering surface tension at the air–water interface and in modifying wetting in waterborne coatings. It also immunizes model colloids against coagulation induced by Debye–Hückel (indifferent electrolyte) electrostatic screening. Further, sol–gel thermoreversibility is unexpectedly found as an additional form of stimuli responsiveness.     

Averaging of Singularly Perturbed Controlled Stochastic Differential Equations

An averaged system to approximate the slow dynamics of a two timescale nonlinear stochastic control system is introduced. Validity of the approximation is established. Special cases are considered to illustrate the general theory.     

Duality in disjunctive linear fractional programming

In this note a dual problem is formulated for a given class of disjunctive linear fractional programming problems. This result generalizes to fractional programming the duality theorem of disjunctive linear programming originated by Balas. Two examples are given to illustrate the result.     

A one-pot access to pyridine/benzo fused cyclododecanes via multi-component tandem reactions

A facile syntheses of novel poly-substituted pyridine/benzo fused cyclododecane hybrid heterocycles have been achieved through one-pot multi-component tandem strategy employing cyclododecanone, aromatic aldehydes and malononitrile.     

Kinetic investigations on interaction of carbon monoxide with RuIICl2(PPh3)3 in mixed aqueous medium

Kinetics, equilibrium and thermodynamics of interaction of CO with RuCl₂(PPh₃)₃ (1) have been investigated in 1:1(v/v) water — 1,4-dioxan mixture in which 1 dissociates to RuCl₂(PPh₃)₂ (1a), by losing a coordinated PPh₃. The kinetics of complexation of (1a) with CO to form RuCl₂(CO)(PPh₃)₂ (2) indicated first order dependence in [1a] and [CO]. The thermodynamic parameters for the formation of 2 were determined.This revised version was published online in December 2005 with corrections to the Cover Date.     

INAA of trace elements in Indian vegetarian diet and its adequacy vis-a-vis Recommended Dietary Allowances

There has been an increasing awareness conceming the adequacy of trace elements in diet as their deficiency or excess may cause abnormal changes in the biochemical processes. Typical Indian vegetarian diet and dietary components such as cereals, grains, pulses, vegetables and spices have been analysed for 19 elements (Br, Cl, Co, Cr, Cu, Fe, Hg, K, Mn, Mo, Na, P, Rb, Sb, Sc, Se, Sr, Th and Zn) by instrumental neutron activation analysis (INAA). Several Standard Reference Materials (SRMs) were analysed for quality assurance. Based on the elemental contents, the daily dietary intake has been calculated and the data compared with those from other countries, Recommended Dietary Allowances (RDAs) and permissible body burden. It has been observed that, although vegetarian, the Indian diet has an adequate content of essential trace elements compared to non-vegetarian oriental (Japan and Taiwan) and western (Germany, Denmark and USA) diets.