Densely functionalized 1,2-dihydrobenzo[b][1,6]naphthyridines: one-pot synthesis via sequential Ugi and Heck reactions

A facile one-pot synthesis of functionalized 1,2-dihydrobenzo[b][1,6]naphthyridines is described via sequential Ugi four components using 2-chloroquinoline-3-carboxaldehydes, allyl amine, acetic acid, isocyanides and ligand free Heck reactions in good yields.     

Recycled de-Oiled Algal Biomass Extract as a Feedstock for Boosting Biodiesel Production from <Emphasis Type="Italic">Chlorella minutissima</Emphasis>

The investigation for the first time assesses the efficacy of recycled de-oiled algal biomass extract (DABE) as a cultivation media to boost lipid productivity in Chlorella minutissima and its comparison with Bold’s basal media (BBM) used as control. Presence of organic carbon (3.8 ± 0.8 g/l) in recycled DABE resulted in rapid growth with twofold increase in biomass productivity as compared to BBM. These cells expressed four folds higher lipid productivity (126 ± 5.54 mg/l/d) as compared to BBM. Cells cultivated in recycled DABE showed large sized lipid droplets accumulating 54.12 % of lipid content. Decrement in carbohydrate (17.76 %) and protein content (28.12 %) with loss of photosynthetic pigments compared to BBM grown cells were also recorded. The fatty acid profiles of cells cultivated in recycled DABE revealed the dominance of C16:0 (39.66 %), C18:1 (29.41 %) and C18:0 (15.82 %), respectively. This model is self-sustained and aims at neutralizing excessive feedstock consumption by exploiting recycled de-oiled algal biomass for cultivation of microalgae, making the process cost effective.     

Synthesis,photophysical, electrochemical and single-crystal x-ray diffraction study of (Z)-2-phenyl-3-(5-(4-(thiophen-2-yl)benzo[c][1,2,5]thiadiazol-7-yl)thiophen-2-yl)acrylonitrile

The optical characteristics, redox properties, thermogravimetric stability and single-crystal X-ray diffraction study of (Z)-2-phenyl-3-(5-(4-(thiophen-2-yl)benzo[c][1,2,5]thiadiazol-7-yl)thiophen-2-yl)acrylonitrile are examined using ultraviolet–visible spectrophotometry, cyclic voltammetry, thermal gravimetric analysis–diffraction scanning calorimetry analysis, single-crystal X-ray diffraction and density functional theory calculations. Evidently, the crystal structure of compound 6 is sustained by a number of weak nonconventional intermolecular forces of attraction such as C-H … N, C-H … π donor–acceptor interactions.     

Insights to Sequence Information of Polyphenol Oxidase Enzyme from Different Source Organisms

Polyphenol oxidases (PPOs) are widely distributed enzymes among animals, plants, bacteria, and fungi. PPOs often have significant role in many biologically essential functions including pigmentation, sclerotization, primary immune response, and host defense mechanisms. In the present study, forty-seven full-length amino acid sequences of PPO from bacteria, fungi, and plants were collected and subjected to multiple sequence alignment (MSA), domain identification, and phylogenetic tree construction. MSA revealed that six histidine, two phenylalanine, two arginine, and two aspartic acid residues were highly conserved in all the analyzed species, while a single cysteine residue was conserved in all the plant and fungal PPOs. Two major sequence clusters were constructed by phylogenetic analysis. One cluster was of the plant origin, whereas the other one was of the fungal and bacterial origin. Motif GGGMMGDVPTANDPIFWLHHCNVDRLWAVWQ was found in all the species of bacterial and fungus sources. In addition, seven new motifs which were unique for their group were also identified.     

Scavenging mechanism of curcumin toward the hydroxyl radical: a theoretical study of reactions producing ferulic acid and vanillin

Curcumin is known to be an antioxidant, as it can scavenge free radicals from biological media. A sequence of H-abstraction and addition reactions involving up to eight OH radicals and curcumin or its degradation products leading to the formation of two other antioxidants, namely, ferulic acid and vanillin, was studied. Single electron transfer from curcumin to an OH radical was also studied. All relevant extrema on the potential energy surfaces were located by optimizing geometries of the reactant and product complexes, as well as those of the transition states, at the BHandHLYP/6-31G(d,p) level of density functional theory in the gas phase. Single-point energy calculations were also performed in the gas phase at the BHandHLYP/aug-cc-pVDZ and B3LYP/aug-cc-pVDZ levels of theory. Solvent effects in aqueous media were treated by performing single-point energy calculations at all of the above-mentioned levels of theory employing the polarizable continuum model and the geometries optimized at the BHandHLYP/6-31G(d,p) level in the gas phase. A few reaction steps were also studied by geometry optimization in aqueous media, and the thus-obtained Gibbs free energy barriers were similar to those obtained by corresponding single-point energy calculations. Our calculations show that the hydrogen atom of the OH group attached to the phenol moiety of curcumin would be most efficiently abstracted by an OH radical, in agreement with experimental observations. Further, our study shows that OH addition would be most favored at the C10 site of the heptadiene chain. It was found that curcumin can serve as an effective antioxidant.     

Solid state characterization of the inclusion complex of valsartan with methyl β-cyclodextrin

In this work, we illustrate the usefulness of cyclodextrins, namely, methyl-β-cyclodextrin (MβCD), an amorphous, methylated derivative of the natural β-cyclodextrin, as a tool to form an inclusion complex with Valsartan (VAL), a poorly water soluble drug. The phase solubility study showed A_L type of curve with slope less than one indicating the formation of complexes in 1:1 molar ratio of drug and CD. The stability constant was found to be 538.14 ± 5.4 Mole^?1. Solid binary systems between VAL and MβCD were prepared experimentally in a stoichiometry 1:1 by different techniques (physical mixing, kneading, co-evaporation). Afterward these products were characterized by Fourier transform infrared spectroscopy (FTIR), Differential scanning calorimetry (DSC), Scanning electron microscopy (SEM) and ¹H Nuclear magnetic resonance study (¹H NMR). The results obtained suggested that co-evaporation methods yield a higher degree of amorphous entities suggesting the formation of inclusion complex between VAL and MβCD. The dissolution of VAL from the binary systems was studied to select the most appropriate system for the formulation development. It was concluded that the preparation technique played an important role in the dissolution behavior of the drug and the inclusion complex between VAL and MβCD obtained by co-evaporation method allowed better performance.     

Crystallization and glass transition kinetics in Cu ion substituted Cux-Ag1 − xI-Ag2O-V2O5 superionic glasses

Crystallization kinetics and thermal properties in superionic glasses Cu_xAg_1 − xI-Ag₂O-V₂O₅ for x = 0.1-0.3 have been thoroughly investigated. X-ray diffraction and differential scanning calorimetry measurements confirm the precipitation of at least three compounds during crystallization, viz. AgI, Ag₄V₂O₇ and Ag₈I₄V₂O₇. The activation energies for structural relaxation (E_s) and crystallization (E_c) obtained using Moynihan and Kissinger formulation exhibit interesting trends with CuI substitution. The E_s value decreases with CuI substitution in the system. Further, the E_c values corresponding to precipitation of Ag₄V₂O₇ and Ag₈I₄V₂O₇ exhibit increasing trend, whereas, for that of AgI precipitation a decreasing trend with CuI content. The Avrami parameter calculated from Augis-Bennett method and Ozawa equation suggests predominantly surface crystallization in the glassy system. The electrical conductivity-temperature (σ-T) cycles interestingly demonstrate increasing precipitation of AgI with CuI content in the glass matrix.     

Evaluation of Anisole‐Substituted Boron Difluoride Formazanate Complexes for Fluorescence Cell Imaging

Evaluation of three subclasses of boron difluoride formazanate complexes bearing o‐, m‐, and p‐anisole N‐aryl substituents (Ar) as readily accessible alternatives to boron dipyrromethene (BODIPY) dyes for cell imaging applications is described. While the wavelengths of maximum absorption (λ_max) and emission (λ_em) observed for each subclass of complexes, which differed by their carbon‐bound substituents (R), were similar, the emission quantum yields for 7 a – c (R=cyano) were enhanced relative to 8 a – c (R=nitro) and 9 a – c (R=phenyl). Complexes 7 a – c and 8 a – c were also significantly easier to reduce electrochemically to their radical anion and dianion forms compared to 9 a – c . Within each subclass, the o‐substituted derivatives were more difficult to reduce, had shorter λ_max and λ_em, and lower emission quantum yields than the p‐substituted analogues as a result of sterically driven twisting of the N‐aryl substituents and a decrease in the degree of π‐conjugation. The m‐substituted complexes were the least difficult to reduce and possessed intermediate λ_max, λ_em, and quantum yields. The complexes studied also exhibited large Stokes shifts (82–152 nm, 2143–5483 cm^?1). Finally, the utility of complex 7 c (Ar=p‐anisole, R=cyano), which can be prepared for just a few dollars per gram, for fluorescence cell imaging was demonstrated. The use of 7 c and 4′,6‐diamino‐2‐phenylindole (DAPI) allowed for simultaneous imaging of the cytoplasm and nucleus of mouse fibroblast cells.