共查询到20条相似文献,搜索用时 62 毫秒
1.
Visceral leishmaniasis (VL) caused by Leishmania donovani is a fatal parasitic disease affecting primarily the poor population in endemic countries. Increasing number of deaths as well as resistant to existing drugs necessitates the development of an effective vaccine for successful treatment of VL. The present study employed a combinatorial approach for designing monomer vaccine construct against L. donovani by applying forecasted B- and T- cell epitopes from 4 genome derived antigenic proteins having secretory signal peptides and glycophosphatidylinositol (GPI) anchors with ≤ 1 transmembrane helix. The forecasted population coverage of chosen T cell epitope ensemble (combined HLA class I and II) cover 99.14 % of world-wide human population. The predicted 3D structure of vaccine constructs (VC1/VC2) were modeled using homology modeling approach and docked to innate immune receptors TLR-2 and TLR-4 with respective docking energies −1231.4/−910.3 and −1119.4/−1476 kcal/mol. Overall, the aforementioned designed vaccine constructs were found appropriate for including in self-assembly protein nanoparticles (SAPN) for further study in developing cutting-edge precision vaccine against VL in short duration with cost-effective manner. 相似文献
2.
《Journal of Coordination Chemistry》2012,65(22):3731-3747
AbstractTwo water-soluble zinc(II) complexes of β-cyclodextrin-based Schiff bases, viz., mono-6-deoxy-6-(4-(5-chloro-2-hydroxybenzylideneamino)-3,4-diaminotolune)-β-cyclodextrin (4a) and mono-6-deoxy-6-(4-(5-nitro-2-hydroxybenzylideneamino)-3,4-diaminotolune)-β-cyclodextrin (4b) have been synthesized and characterized by different analytical and spectroscopic techniques. These Zn(II) complexes were analyzed for their possible activity against oxidative stress through various biochemical methods. A detailed antioxidant profile directly associated with inflammation related carcinogenesis and several oxidative stress related disorders have been prepared with a motive to evaluate the free radical scavenging activities of the synthesized complexes. The immune cell cytotoxic properties (through MTT assay) and in vitro assay for the evaluation of their antioxidant activities against hydroxyl radical, nitric oxide, singlet oxygen, peroxynitrate and hydrogen peroxide, etc. were investigated. Obtained results clearly demonstrated the role of reactive oxygen species in various phases of oxidative stress related diseases; thus, the antioxidant and free radical scavenging capacities of the two synthesized Zn(II) complexes seem to stand in support of their beneficial effects and novelty for the immune system. 相似文献
3.
In recent years, Mitogen-Activated Protein Kinase (MAPK) pathways have emerged as major regulators of cellular physiology. In the fungal pathogen Candida albicans, three different MAPK pathways have been characterized in the last years. The HOG pathway is mainly a stress response pathway that is activated in response to osmotic and oxidative stress and also participates regulating other pathways. The SVG pathway (or mediated by the Cek1 MAPK) is involved in cell wall formation under vegetative and filamentous growth, while the Mkc1-mediated pathway is involved in cell wall integrity. Oxidative stress is one of the types of stress that every fungal cell has to face during colonization of the host, where the cell encounters both hypoxia niches (i.e. gut) and high concentrations of reactive oxygen species (upon challenge with immune cells). Two pathways have been shown to be activated in response to oxidative stress: the HOG pathway and the MKC1-mediated pathway while the third, the Cek1 pathway is deactivated. The timing, kinetics, stimuli and functional responses generated upon oxidative stress differ among them; however, they have essential functional consequences that severely influence pathogenesis. MAPK pathways are, therefore, valuable targets to be explored in antifungal research. 相似文献
4.
Sylwia Stczek Agnieszka Zdybicka-Barabas Iwona Wojda Adrian Wiater Pawe Mak Piotr Suder Krzysztof Skrzypiec Magorzata Cytryska 《Molecules (Basel, Switzerland)》2021,26(16)
Recognition of pathogen-associated molecular patterns (PAMPs) by appropriate pattern recognition receptors (PRRs) is a key step in activating the host immune response. The role of a fungal PAMP is attributed to β-1,3-glucan. The role of α-1,3-glucan, another fungal cell wall polysaccharide, in modulating the host immune response is not clear. This work investigates the potential of α-1,3-glucan as a fungal PAMP by analyzing the humoral immune response of the greater wax moth Galleria mellonella to Aspergillus niger α-1,3-glucan. We demonstrated that 57-kDa and 61-kDa hemolymph proteins, identified as β-1,3-glucan recognition proteins, bound to A. niger α-1,3-glucan. Other hemolymph proteins, i.e., apolipophorin I, apolipophorin II, prophenoloxidase, phenoloxidase activating factor, arylphorin, and serine protease, were also identified among α-1,3-glucan-interacting proteins. In response to α-1,3-glucan, a 4.5-fold and 3-fold increase in the gene expression of antifungal peptides galiomicin and gallerimycin was demonstrated, respectively. The significant increase in the level of five defense peptides, including galiomicin, corresponded well with the highest antifungal activity in hemolymph. Our results indicate that A. niger α-1,3-glucan is recognized by the insect immune system, and immune response is triggered by this cell wall component. Thus, the role of a fungal PAMP for α-1,3-glucan can be postulated. 相似文献
5.
Klebsiella pneumoniae is declared as antibiotic resistant by WHO, with the critical urgency of developing novel antimicrobial therapeutics as drug resistance is the second most dangerous threat after terrorism. Besides many attempts still, there is no effective vaccine available against K. pneumoniae. By utilizing all the available proteomic data we prioritized the novel proteins ideal for vaccine development using bioinformatics tools and techniques. Among the huge data, eight proteins passed all the barriers and were considered ideal candidates for vaccine development. These include: copper silver efflux system outer membrane protein (CusC), outer membrane porin protein (OmpN), Fe++ enterobactin transporter substrate binding protein (fepB), zinc transporter substrate binding protein (ZnuA), ribonuclease HI, tellurite resistant methyltransferase (the B), and two uncharacterized hypothetical proteins (WP_002918223 and WP_002892366). These proteins were also subjected to epitope analysis and were found best for developing subunit vaccine against K. pneumoniae. The study shows that the potential vaccine targets are sufficiently efficient being virulent, of outer membranous origin and can be proposed for the DNA third-generation vaccines development that would help to cope up infections caused by multidrug-resistant K. pneumoniae. 相似文献
6.
Wang Y Oberley LW Howe D Jarvis DL Chauhan G Murhammer DW 《Applied biochemistry and biotechnology》2004,119(2):181-193
It has previously been demonstrated that baculovirus infection of the Spodoptera frugiperda Sf-9 (Sf-9) and Trichoplusia ni BTI-Tn-5B1-4 (Tn-5B1-4) insect cell lines leads to oxidative stress as measured by protein and membrane lipid oxidation and
that this oxidative damage contributes to cell death. As a result of these findings, it was hypothesized that baculovirus
infection stimulates superoxide radical (O
2
·—
synthesis in the mitochondria and that the resulting O
2
·—
accumulation overwhelms the cells’ antioxidant defenses. We investigated the ability of manganese superoxide dismutase (MnSOD)
expression (which reduces O
2
·—
to H2O2) to overcome the oxidative damage caused by baculovirus infection. It was found that MnSOD expression significantly reduced
oxidative damage in baculovirus-infected Tn-5B1-4 cells but had no significant effect on oxidative damage in baculovirus-infected
Sf-9 cells. The results are consistent with the hypothesis that O
2
·—
accumulation in the mitochondria is at least partially responsible for the oxidative damage resulting from the baculovirus
infection of insect cells. 相似文献
7.
ABSTRACTA repeat unit of cell wall teichoic acids (WTA) isolated from E. faecium U0317 was chemically synthesized efficiently by a stepwise strategy. It was derivatized with a 5-aminopentanyl linker to facilitate conjugation with carrier proteins KLH and HSA. Immunological studies of the KLH conjugate 1 demonstrated that it could provoke robust immune responses and high titers of IgG antibodies, which could successfully recognize the synthesized WTA repeat unit 3. This result suggested that synthetic glycoconjugate 1 could be a promising vaccine candidate against E. faecium for further studies. 相似文献
8.
Several plant products are known to exhibit immense medicinal value against human diseases. Our earlier studies showed that
dry stem crude extract (DSCE) ofTinospora cordifolia contained a polyclonal B cell mitogen, G1-4A. DSCE as well as G1-4A also enhanced immune response in mice. In order to explore
the possibility of using G1-4A/PPI (partially purified immunomodulator) to modulate radiation induced immunosuppression, the
antioxidant effect of PPI from this plant was examined against reactive oxygen and nitrogen species (ROS/RNS), generated by
photosensitization/peroxynitrite. Levels of lipid peroxidation products, superoxide dismutase (SOD) and catalase in liver/spleen
homogenate from mouse were monitored. Photosensitization induced significant increase in thiobarbituric acid reactive substances
(TBARS) in liver. The activities of SOD and catalase were reduced considerably. PPI, present during photosensitisation, prevented
lipid peroxidation and restored the activities of both the enzymes. Likewise, oxidative damage induced by peroxynitrite was
inhibited by PPI. The degradation of proteins due to photosensitization as assessed by SDS-PAGE was effectively reduced by
simultaneous treatment with PPI during photosensitization. Selective inhibitors of ROS like mannitol, SOD, sodium azide and
antioxidants, GSH and vitamin C brought about significant inhibition of formation of TBARS suggesting possible involvement
of O2
•,•OH and1O2. Photosensitization in deuterated buffer enhanced formation of TBARS thus indicating generation of1O2. Thus, the action of PPI may be against oxidative damage through Type I and II photosensitization mechanisms. Therefore,
the immunomodulator fromTinospora cordifolia may also be beneficial as an antioxidant. 相似文献
9.
Virulence-related outer membrane proteins (Omps) are expressed in bacteria (Gram-negative) such as V. cholerae and are vital to bacterial invasion in to eukaryotic cell and survival within macrophages that could be best candidate for development of vaccine against V. cholerae. Applying in silico approaches, the 3-D model of the Omp was developed using Swiss model server and validated byProSA and Procheck web server. The continuous stretch of amino acid sequences 26 mer: RTRSNSGLLTWGDKQTITLEYGDPAL and 31 mer: FFAGGDNNLRGYGYKSISPQDASGALTGAKY having B-cell binding sites were selected from sequence alignment after B cell epitopes prediction by BCPred and AAP prediction modules of BCPreds. Further, the selected antigenic sequences (having B-cell epitopes) were analyzed for T-cell epitopes (MHC I and MHC II alleles binding sequence) by using ProPred 1 and ProPred respectively. The epitope (9 mer: YKSISPQDA) that binds to both the MHC classes (MHC I and MHC II) and covers maximum MHC alleles were identified. The identified epitopes can be useful in designing comprehensive peptide vaccine development against V. cholerae by inducing optimal immune response. 相似文献
10.
Ali Badiee Mahmoud R. Jaafari Ali Khamesipour Afshin Samiei Dina Soroush Masoumeh Tavassoti Kheiri Farzaneh Barkhordari W. Robert McMaster Fereidoun Mahboudi 《Colloids and surfaces. B, Biointerfaces》2009,74(1):37-44
Development of new generation vaccines requires adjuvants to elicit the type and intensity of immune response needed for protection. Liposomes have been shown to be an effective adjuvant formulation. In this study, the role of liposome bilayer composition with different phase transition temperature (Tc) to induce a T helper 1 (Th1) type of immune response and protection against leishmaniasis in BALB/c mice was assessed. Liposome formulations with different bilayer compositions consisting of egg phosphatidylcholine (EPC, Tc < 0 °C), dipalmitoylphosphatidylcholine (DPPC, Tc 41 °C), or distearoylphosphatidylcholine (DSPC, Tc 54 °C) were prepared. All liposomes were contained rgp63 as a recombinant antigen and used to immunize mice subcutaneously 3 times in 3-week intervals. Evaluation of lesion development and splenic parasite burden after challenge with L. major, evaluation of Th1 cytokine (IFN-γ) and Th2 cytokine (IL-4), and titration of IgG isotypes were carried out to assess the type of generated immune response and extent of protection. The results indicated the generated immune response in mice was influenced by the bilayer composition of liposomes, so that mice immunized with liposomes consisting of EPC induced a Th2 type of immune response while liposome consisting of DPPC or DSPC induced Th1 type of immune response. It seems that liposomes prepared with higher Tm phospholipids are suitable formulation to induce Th1 type of immune response and protection, and so might be used for further investigations to develop an effective vaccine against leishmaniasis. 相似文献
11.
Protective effects of transduced Tat-DJ-1 protein against oxidative stress and ischemic brain injury
Hoon Jae Jeong Dae Won Kim Mi Jin Kim Su Jung Woo Hye Ri Kim So Mi Kim Hyo Sang Jo Hyun Sook Hwang Duk-Soo Kim Sung-Woo Cho Moo Ho Won Kyu Hyung Han Jinseu Park Won Sik Eum Soo Young Choi 《Experimental & molecular medicine》2012,44(10):586-593
12.
BackgroundMetastasis is the main cause of breast cancer (BC) lethality, especially in early stages, led to improvements in therapeutic procedures. Lately, by improvements in our perception of biological processes and immune system new classes of vaccines are emerged that grant us the opportunity of designing resolute constructs against desired antigens. In the current study, we used a variety of immunoinformatics tools to design a novel cancer vaccine against Preferentially Expressed Antigen of Melanoma (PRAME), which counts as a cancer testis antigen for various human cancers including BC. The PRAME up-regulation leads to strengthen BC stem cells maintenance, drug resistance, cell survival, adaptation, and apoptosis evading in cancerous cells.Methods and resultsThe PRAME co-expressed genes were mined and validated through BC RNA-sequencing of TCGA data. The immunodominant T-cell predicted epitopes were fused and engineered to form the vaccine. The safety, allergenicity, and immunogenic capabilities of the vaccine were confirmed by promising immunoinformatics tools. The vaccine’s structure was verified to be hydrophilic in most areas through Kyte and Doolittle hydrophobicity plotting. The interactions between the designed vaccine and immune receptors of TLR4 and IL1R were confirmed by protein-protein docking after modeling its tertiary structure. Finally, codon optimization and in silico cloning were performed to guarantee better in-vivo results.ConclusionIn conclusion, concerning in silico assessments’ results in this study, the designed vaccine can potentially boost immune responses against PRAME, therefore may decrease BC development and metastasis. According to the mined PRAME co-expressed genes and their functional annotation, cell cycle regulation is the prime mechanism opted by this construct and its adjacent regulatory genes along boosting immune reactions. 相似文献
13.
14.
Background
Dictyostelium cells exhibit an unusual stress response as they protect themselves against hyperosmotic stress. Cytoskeletal proteins are recruited from the cytosolic pool to the cell cortex, thereby reinforcing it. In order to gain more insight into the osmoprotective mechanisms of this amoeba, we used 1-D and 2-D gel electrophoresis to identify new proteins that are translocated during osmotic shock. 相似文献15.
16.
Dr. Vadim B. Krylov Dr. Alexey G. Gerbst Dmitry A. Argunov Dr. Andrey S. Dmitrenok Prof. Dr. Alexander S. Shashkov Prof. Dr. Zbigniew Kaczynski Prof. Dr. Johannes Huebner Prof. Dr. Otto Holst Prof. Dr. Nikolay E. Nifantiev 《Chemistry (Weinheim an der Bergstrasse, Germany)》2015,21(4):1749-1754
Enterococcus faecalis is one of most important nosocomial and often multi‐antibiotic resistant pathogens responsible for infections that are difficult to treat. Previously, a cell‐wall polysaccharide termed diheteroglycan (DHG) was isolated and characterized as a promising vaccine candidate. However, the configuration of its lactic acid (LA) residue attached to the galactofuranoside unit was not assessed, although it influences conformation of DHG chain in terms of biological recognition and immune evasion. This study proves the R configuration of the LA residue by means of chemical analysis, investigation of intramolecular NMR nuclear Overhauser effects and molecular dynamics simulations of native DHG and corresponding R and S models, which were obtained by using pyranoside‐into‐furanoside rearrangement. As alternative treatment and prevention strategies for E. faecalis are desperately needed, this discovery may offer the prospect of a synthetic vaccine to actively immunize patients at risk. 相似文献
17.
Nipah virus and Hendra virus, two members of the genus Henipavirus, are newly emerging zoonotic pathogens which cause acute respiratory illness and severe encephalitis in human. Lack of the effective antiviral therapy endorses the urgency for the development of vaccine against these deadly viruses. In this study, we employed various computational approaches to identify epitopes which has the potential for vaccine development. By analyzing the immune parameters of the conserved sequences of G glycoprotein using various databases and bioinformatics tools, we identified two potential epitopes which may be used as peptide vaccines. Using different B cell epitope prediction servers, four highly similar B cell epitopes were identified. Immunoinformatics analyses revealed that LAEDDTNAQKT is a highly flexible and accessible B-cell epitope to antibody. Highly similar putative CTL epitopes were analyzed for their binding with the HLA-C 12*03 molecule. Docking simulation assay revealed that LTDKIGTEI has significantly lower binding energy, which bolstered its potential as epitope-based vaccine design. Finally, cytotoxicity analysis has also justified their potential as promising epitope-based vaccine candidate. In sum, our computational analysis indicates that either LAEDDTNAQKT or LTDKIGTEI epitope holds a promise for the development of universal vaccine against all kinds of pathogenic Henipavirus. Further in vivo and in vitro studies are necessary to validate the obtained findings. 相似文献
18.
Rene F. Roller Ankita Malik Maria A. Carillo Monika Garg Antonella Rella Marie‐Kristin Raulf Bernd Lepenies Peter H. Seeberger Daniel Varn Silva 《Angewandte Chemie (International ed. in English)》2020,59(29):12035-12040
Glypiation is a common posttranslational modification of eukaryotic proteins involving the attachment of a glycosylphosphatidylinositol (GPI) glycolipid. GPIs contain a conserved phosphoglycan that is modified in a cell‐ and tissue‐specific manner. GPI complexity suggests roles in biological processes and effects on the attached protein, but the difficulties to get homogeneous material have hindered studies. We disclose a one‐pot intein‐mediated ligation (OPL) to obtain GPI‐anchored proteins. The strategy enables the glypiation of folded and denatured proteins with a natural linkage to the glycolipid. Using the strategy, glypiated eGFP, Thy1, and the Plasmodium berghei protein MSP119 were prepared. Glypiation did not alter the structure of eGFP and MSP119 proteins in solution, but it induced a strong pro‐inflammatory response in vitro. The strategy provides access to glypiated proteins to elucidate the activity of this modification and for use as vaccine candidates against parasitic infections. 相似文献
19.
《Annales de l'Institut Pasteur. Immunologie》1988,139(2):143-156
Attempts to develop a satisfactory vaccine against New World cutaneous leishmaniasis have been made with varying success. We found that in mice, pretreated subcutaneously with 2×106 BCG organisms 2 weeks prior to immunization at the same site with as low as 10 μg of a microsomal preparation (Pol-F) of Leishmania mexicana amazonensis, a profound alteration was observed in the course of infection produced by inoculation of virulent amastigotes of the same strain. The BCG-Pol-F vaccine preparation was consistently shown to have a protective capacity associated with larger classical cellular immune response (skin test) and higher specific antibody titres in response to leishmanial challenge dose (1 × 106 amastigotes/mouse). 相似文献
20.
Azam Rezvanirad Mehri Habibi Mehdi Farokhi Mohammad Reza Asadi Karam 《Macromolecular bioscience》2023,23(9):2300074
Pseudomonas aeruginosa (P. aeruginosa) causing urinary tract infections (UTIs) are a major concern among hospital-acquired infections. The need for an effective vaccine that reduces the infections is imperative. This study aims to evaluate the efficacy of a multi-epitope vaccine encapsulated in silk fibroin nanoparticles (SFNPs) against P. aeruginosa-mediated UTIs. A multi-epitope is constructed from nine proteins of P. aeruginosa using immunoinformatic analysis, expressed, and purified in BL21 (DE3) cells. The encapsulation efficiency of the multi-epitope in SFNPs is 85% with a mean particle size of 130 nm and 24% of the encapsulated antigen is released after 35 days. The vaccine formulations adjuvanted with SFNPs or alum significantly improve systemic and mucosal humoral responses and the cytokine profile (IFN-γ, IL-4, and IL-17) in mice. Additionally, the longevity of the IgG response is maintained for at least 110 days in a steady state. In a bladder challenge, mice treated with the multi-epitope admixed with alum or encapsulated in SFNPs demonstrate significant protection of the bladder and kidneys against P. aeruginosa. This study highlights the promising therapeutic potential of a multi-epitope vaccine encapsulated in SFNPs or adjuvanted with alum against P. aeruginosa infections. 相似文献